PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN38983.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 361aa    MW: 40500.9 Da    PI: 7.0681
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN38983.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.5e-174592148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEde l++++++ G g+W+t +++ g+ R++k+c++rw +yl
       KHN38983.1 45 RGPWTPEEDEVLANYINKEGEGRWRTLPKRAGLLRCGKSCRLRWMNYL 92
                     89******************************99************97 PP

2Myb_DNA-binding46.58.4e-15103143648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++E++l+++++++lG++ W++Ia +++ gRt++++k++w+++l
       KHN38983.1 103 PDEEDLILRLHRLLGNR-WSLIAGRIP-GRTDNEIKNYWNTHL 143
                      89***************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-223694IPR009057Homeodomain-like
PROSITE profilePS5129415.7434092IPR017930Myb domain
SuperFamilySSF466898.07E-2942139IPR009057Homeodomain-like
SMARTSM007171.2E-124494IPR001005SANT/Myb domain
PfamPF002494.6E-154592IPR001005SANT/Myb domain
CDDcd001671.42E-104792No hitNo description
PROSITE profilePS5129424.40493147IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.5E-2495148IPR009057Homeodomain-like
SMARTSM007171.2E-1397145IPR001005SANT/Myb domain
CDDcd001671.42E-11103143No hitNo description
PfamPF002491.4E-13103143IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MRNPSLPTLA TTKTKVKNNS NKSTNNNNNI GTNYSPCCNN VGLKRGPWTP EEDEVLANYI  60
NKEGEGRWRT LPKRAGLLRC GKSCRLRWMN YLRPSVKRGH IAPDEEDLIL RLHRLLGNRW  120
SLIAGRIPGR TDNEIKNYWN THLSKKLINQ GIDPRTHKPL NPPSIAVPSS STTSTIPPSK  180
PPPVIITNNN INPFHHDLTN MFNQGVHLNH LGQHHQPPPL SNPCDNHNPV PAAATDDVSA  240
MGFMDNNNED CNNDGININY YSDDVFSSFL NSLINDDAFE AQQQQHHVQT EIPTPSERSI  300
NPLPCDDRVD DHHLGSITTA SASQGYDDEL GVLWESPLVS ATFSQHVNDH ITKRVHDHHN  360
Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-24431472105MYB PROTO-ONCOGENE PROTEIN
1mse_C1e-24431472105C-Myb DNA-Binding Domain
1msf_C1e-24431472105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5979320.0AB597932.1 Glycine max W2 mRNA for R2R3 MYB transcription factor, complete cds, cultivar: Harosoy.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001241492.10.0transcription repressor MYB5-like
SwissprotQ388506e-82MYB5_ARATH; Transcription repressor MYB5
TrEMBLA0A0B2S2U40.0A0A0B2S2U4_GLYSO; Transcription repressor MYB5
TrEMBLF5HQF10.0F5HQF1_SOYBN; R2R3 MYB transcription factor
STRINGGLYMA14G24500.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38943064
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.17e-79myb domain protein 5
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]